Anti THEMIS pAb (ATL-HPA031425)

Atlas Antibodies

Catalog No.: ATL-HPA031425-25

Protein Description: thymocyte selection associated
Gene Name: THEMIS
Alternative Gene Name: bA325O24.3, bA325O24.4, C6orf190, C6orf207, FLJ40584, TSEPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049109: 79%, ENSRNOG00000014979: 79%
Entrez Gene ID: 387357
Uniprot ID: Q8N1K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF
• Gene Sequence: EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF
• Gene ID - Mouse: ENSMUSG00000049109
• Gene ID - Rat: ENSRNOG00000014979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti THEMIS pAb (ATL-HPA031425) – 1 Found

Paster, Wolfgang; Bruger, Annika M; Katsch, Kristin; Grégoire, Claude; Roncagalli, Romain; Fu, Guo; Gascoigne, Nicholas R J; Nika, Konstantina; Cohnen, Andre; Feller, Stephan M; Simister, Philip C; Molder, Kelly C; Cordoba, Shaun-Paul; Dushek, Omer; Malissen, Bernard; Acuto, Oreste. A THEMIS:SHP1 complex promotes T-cell survival. The Embo Journal. 2015;34(3):393-409.