Anti THEM6 pAb (ATL-HPA023255)

Atlas Antibodies

Catalog No.: ATL-HPA023255-25

Protein Description: thioesterase superfamily member 6
Gene Name: THEM6
Alternative Gene Name: C8orf55, DSCD75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056665: 88%, ENSRNOG00000005929: 88%
Entrez Gene ID: 51337
Uniprot ID: Q8WUY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
• Gene Sequence: LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
• Gene ID - Mouse: ENSMUSG00000056665
• Gene ID - Rat: ENSRNOG00000005929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.