Anti THBD pAb (ATL-HPA002982)

Atlas Antibodies

Catalog No.:
ATL-HPA002982-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: thrombomodulin
Gene Name: THBD
Alternative Gene Name: CD141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074743: 62%, ENSRNOG00000004687: 61%
Entrez Gene ID: 7056
Uniprot ID: P07204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYG
Gene Sequence DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYG
Gene ID - Mouse ENSMUSG00000074743
Gene ID - Rat ENSRNOG00000004687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THBD pAb (ATL-HPA002982)
Datasheet Anti THBD pAb (ATL-HPA002982) Datasheet (External Link)
Vendor Page Anti THBD pAb (ATL-HPA002982) at Atlas Antibodies

Documents & Links for Anti THBD pAb (ATL-HPA002982)
Datasheet Anti THBD pAb (ATL-HPA002982) Datasheet (External Link)
Vendor Page Anti THBD pAb (ATL-HPA002982)