Anti THBD pAb (ATL-HPA002982)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002982-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: THBD
Alternative Gene Name: CD141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074743: 62%, ENSRNOG00000004687: 61%
Entrez Gene ID: 7056
Uniprot ID: P07204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYG |
| Gene Sequence | DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYG |
| Gene ID - Mouse | ENSMUSG00000074743 |
| Gene ID - Rat | ENSRNOG00000004687 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THBD pAb (ATL-HPA002982) | |
| Datasheet | Anti THBD pAb (ATL-HPA002982) Datasheet (External Link) |
| Vendor Page | Anti THBD pAb (ATL-HPA002982) at Atlas Antibodies |
| Documents & Links for Anti THBD pAb (ATL-HPA002982) | |
| Datasheet | Anti THBD pAb (ATL-HPA002982) Datasheet (External Link) |
| Vendor Page | Anti THBD pAb (ATL-HPA002982) |