Anti THAP11 pAb (ATL-HPA042189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042189-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: THAP11
Alternative Gene Name: CTG-B43a, CTG-B45d, HRIHFB2206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036442: 85%, ENSRNOG00000019109: 88%
Entrez Gene ID: 57215
Uniprot ID: Q96EK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAE |
| Gene Sequence | QQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAE |
| Gene ID - Mouse | ENSMUSG00000036442 |
| Gene ID - Rat | ENSRNOG00000019109 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THAP11 pAb (ATL-HPA042189) | |
| Datasheet | Anti THAP11 pAb (ATL-HPA042189) Datasheet (External Link) |
| Vendor Page | Anti THAP11 pAb (ATL-HPA042189) at Atlas Antibodies |
| Documents & Links for Anti THAP11 pAb (ATL-HPA042189) | |
| Datasheet | Anti THAP11 pAb (ATL-HPA042189) Datasheet (External Link) |
| Vendor Page | Anti THAP11 pAb (ATL-HPA042189) |