Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004728-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: transglutaminase 3
Gene Name: TGM3
Alternative Gene Name: TGE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027401: 72%, ENSRNOG00000006753: 71%
Entrez Gene ID: 7053
Uniprot ID: Q08188
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQYEKYLKSDNMI
Gene Sequence GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQYEKYLKSDNMI
Gene ID - Mouse ENSMUSG00000027401
Gene ID - Rat ENSRNOG00000006753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation)
Datasheet Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation)
Datasheet Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation)
Citations for Anti TGM3 pAb (ATL-HPA004728 w/enhanced validation) – 1 Found
Uemura, Norihisa; Nakanishi, Yukihiro; Kato, Hoichi; Saito, Shigeru; Nagino, Masato; Hirohashi, Setsuo; Kondo, Tadashi. Transglutaminase 3 as a prognostic biomarker in esophageal cancer revealed by proteomics. International Journal Of Cancer. 2009;124(9):2106-15.  PubMed