Anti TFF1 pAb (ATL-HPA003425 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003425-25

Protein Description: trefoil factor 1
Gene Name: TFF1
Alternative Gene Name: BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024032: 64%, ENSRNOG00000001164: 66%
Entrez Gene ID: 7031
Uniprot ID: P04155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
• Gene Sequence: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
• Gene ID - Mouse: ENSMUSG00000024032
• Gene ID - Rat: ENSRNOG00000001164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TFF1 pAb (ATL-HPA003425 w/enhanced validation) – 7 Found

Liu, Jing; Ottaviani, Daniela; Sefta, Meriem; Desbrousses, Céline; Chapeaublanc, Elodie; Aschero, Rosario; Sirab, Nanor; Lubieniecki, Fabiana; Lamas, Gabriela; Tonon, Laurie; Dehainault, Catherine; Hua, Clément; Fréneaux, Paul; Reichman, Sacha; Karboul, Narjesse; Biton, Anne; Mirabal-Ortega, Liliana; Larcher, Magalie; Brulard, Céline; Arrufat, Sandrine; Nicolas, André; Elarouci, Nabila; Popova, Tatiana; Némati, Fariba; Decaudin, Didier; Gentien, David; Baulande, Sylvain; Mariani, Odette; Dufour, Florent; Guibert, Sylvain; Vallot, Céline; Rouic, Livia Lumbroso-Le; Matet, Alexandre; Desjardins, Laurence; Pascual-Pasto, Guillem; Suñol, Mariona; Catala-Mora, Jaume; Llano, Genoveva Correa; Couturier, Jérôme; Barillot, Emmanuel; Schaiquevich, Paula; Gauthier-Villars, Marion; Stoppa-Lyonnet, Dominique; Golmard, Lisa; Houdayer, Claude; Brisse, Hervé; Bernard-Pierrot, Isabelle; Letouzé, Eric; Viari, Alain; Saule, Simon; Sastre-Garau, Xavier; Doz, François; Carcaboso, Angel M; Cassoux, Nathalie; Pouponnot, Celio; Goureau, Olivier; Chantada, Guillermo; de Reyniès, Aurélien; Aerts, Isabelle; Radvanyi, François. A high-risk retinoblastoma subtype with stemness features, dedifferentiated cone states and neuronal/ganglion cell gene expression. Nature Communications. 2021;12(1):5578. 

Pontén, F; Jirström, K; Uhlen, M. The Human Protein Atlas--a tool for pathology. The Journal Of Pathology. 2008;216(4):387-93. 

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. 

Davidson, Ben; Stavnes, Helene Tuft; Holth, Arild; Chen, Xu; Yang, Yanqin; Shih, Ie-Ming; Wang, Tian-Li. Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions. Journal Of Cellular And Molecular Medicine. 2011;15(3):535-44. 

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458. 

Drabovich, Andrei P; Pavlou, Maria P; Schiza, Christina; Diamandis, Eleftherios P. Dynamics of Protein Expression Reveals Primary Targets and Secondary Messengers of Estrogen Receptor Alpha Signaling in MCF-7 Breast Cancer Cells. Molecular & Cellular Proteomics : Mcp. 2016;15(6):2093-107. 

Saha, Arka; Gavert, Nancy; Brabletz, Thomas; Ben-Ze'ev, Avri. Downregulation of the Tumor Suppressor TFF1 Is Required during Induction of Colon Cancer Progression by L1. Cancers. 2022;14(18)