Anti TFAP2D pAb (ATL-HPA048962)

Atlas Antibodies

Catalog No.:
ATL-HPA048962-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
Gene Name: TFAP2D
Alternative Gene Name: TFAP2BL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042596: 98%, ENSRNOG00000011642: 98%
Entrez Gene ID: 83741
Uniprot ID: Q7Z6R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK
Gene Sequence TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK
Gene ID - Mouse ENSMUSG00000042596
Gene ID - Rat ENSRNOG00000011642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFAP2D pAb (ATL-HPA048962)
Datasheet Anti TFAP2D pAb (ATL-HPA048962) Datasheet (External Link)
Vendor Page Anti TFAP2D pAb (ATL-HPA048962) at Atlas Antibodies

Documents & Links for Anti TFAP2D pAb (ATL-HPA048962)
Datasheet Anti TFAP2D pAb (ATL-HPA048962) Datasheet (External Link)
Vendor Page Anti TFAP2D pAb (ATL-HPA048962)
Citations for Anti TFAP2D pAb (ATL-HPA048962) – 1 Found
Fraune, Christoph; Harms, Luisa; Büscheck, Franziska; Höflmayer, Doris; Tsourlakis, Maria Christina; Clauditz, Till S; Simon, Ronald; Möller, Katharina; Luebke, Andreas M; Möller-Koop, Christina; Steurer, Stefan; Hube-Magg, Claudia; Sauter, Guido; Weidemann, Sören; Lebok, Patrick; Dum, David; Kind, Simon; Minner, Sarah; Izbicki, Jakob R; Schlomm, Thorsten; Huland, Hartwig; Heinzer, Hans; Burandt, Eike; Haese, Alexander; Graefen, Markus; Schroeder, Cornelia. Upregulation of the transcription factor TFAP2D is associated with aggressive tumor phenotype in prostate cancer lacking the TMPRSS2:ERG fusion. Molecular Medicine (Cambridge, Mass.). 2020;26(1):24.  PubMed