Anti TFAP2D pAb (ATL-HPA048962)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048962-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TFAP2D
Alternative Gene Name: TFAP2BL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042596: 98%, ENSRNOG00000011642: 98%
Entrez Gene ID: 83741
Uniprot ID: Q7Z6R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK |
Gene Sequence | TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK |
Gene ID - Mouse | ENSMUSG00000042596 |
Gene ID - Rat | ENSRNOG00000011642 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TFAP2D pAb (ATL-HPA048962) | |
Datasheet | Anti TFAP2D pAb (ATL-HPA048962) Datasheet (External Link) |
Vendor Page | Anti TFAP2D pAb (ATL-HPA048962) at Atlas Antibodies |
Documents & Links for Anti TFAP2D pAb (ATL-HPA048962) | |
Datasheet | Anti TFAP2D pAb (ATL-HPA048962) Datasheet (External Link) |
Vendor Page | Anti TFAP2D pAb (ATL-HPA048962) |
Citations for Anti TFAP2D pAb (ATL-HPA048962) – 1 Found |
Fraune, Christoph; Harms, Luisa; Büscheck, Franziska; Höflmayer, Doris; Tsourlakis, Maria Christina; Clauditz, Till S; Simon, Ronald; Möller, Katharina; Luebke, Andreas M; Möller-Koop, Christina; Steurer, Stefan; Hube-Magg, Claudia; Sauter, Guido; Weidemann, Sören; Lebok, Patrick; Dum, David; Kind, Simon; Minner, Sarah; Izbicki, Jakob R; Schlomm, Thorsten; Huland, Hartwig; Heinzer, Hans; Burandt, Eike; Haese, Alexander; Graefen, Markus; Schroeder, Cornelia. Upregulation of the transcription factor TFAP2D is associated with aggressive tumor phenotype in prostate cancer lacking the TMPRSS2:ERG fusion. Molecular Medicine (Cambridge, Mass.). 2020;26(1):24. PubMed |