Anti TET3 pAb (ATL-HPA050845)

Atlas Antibodies

Catalog No.:
ATL-HPA050845-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tet methylcytosine dioxygenase 3
Gene Name: TET3
Alternative Gene Name: hCG_40738, MGC22014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034832: 91%, ENSRNOG00000011387: 88%
Entrez Gene ID: 200424
Uniprot ID: O43151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Gene Sequence SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Gene ID - Mouse ENSMUSG00000034832
Gene ID - Rat ENSRNOG00000011387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TET3 pAb (ATL-HPA050845)
Datasheet Anti TET3 pAb (ATL-HPA050845) Datasheet (External Link)
Vendor Page Anti TET3 pAb (ATL-HPA050845) at Atlas Antibodies

Documents & Links for Anti TET3 pAb (ATL-HPA050845)
Datasheet Anti TET3 pAb (ATL-HPA050845) Datasheet (External Link)
Vendor Page Anti TET3 pAb (ATL-HPA050845)
Citations for Anti TET3 pAb (ATL-HPA050845) – 1 Found
Qiu, ZhiJun; Lin, An-Ping; Jiang, Shoulei; Elkashef, Sara M; Myers, Jamie; Srikantan, Subramanya; Sasi, Binu; Cao, John Z; Godley, Lucy A; Rakheja, Dinesh; Lyu, Yingli; Zheng, Siyuan; Madesh, Muniswamy; Shiio, Yuzuru; Dahia, Patricia L M; Aguiar, Ricardo C T. MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome. Cell Chemical Biology. 2020;27(5):538-550.e7.  PubMed