Anti TET3 pAb (ATL-HPA050845)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050845-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TET3
Alternative Gene Name: hCG_40738, MGC22014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034832: 91%, ENSRNOG00000011387: 88%
Entrez Gene ID: 200424
Uniprot ID: O43151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH |
| Gene Sequence | SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH |
| Gene ID - Mouse | ENSMUSG00000034832 |
| Gene ID - Rat | ENSRNOG00000011387 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TET3 pAb (ATL-HPA050845) | |
| Datasheet | Anti TET3 pAb (ATL-HPA050845) Datasheet (External Link) |
| Vendor Page | Anti TET3 pAb (ATL-HPA050845) at Atlas Antibodies |
| Documents & Links for Anti TET3 pAb (ATL-HPA050845) | |
| Datasheet | Anti TET3 pAb (ATL-HPA050845) Datasheet (External Link) |
| Vendor Page | Anti TET3 pAb (ATL-HPA050845) |
| Citations for Anti TET3 pAb (ATL-HPA050845) – 1 Found |
| Qiu, ZhiJun; Lin, An-Ping; Jiang, Shoulei; Elkashef, Sara M; Myers, Jamie; Srikantan, Subramanya; Sasi, Binu; Cao, John Z; Godley, Lucy A; Rakheja, Dinesh; Lyu, Yingli; Zheng, Siyuan; Madesh, Muniswamy; Shiio, Yuzuru; Dahia, Patricia L M; Aguiar, Ricardo C T. MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome. Cell Chemical Biology. 2020;27(5):538-550.e7. PubMed |