Anti TDRKH pAb (ATL-HPA019625)

Atlas Antibodies

Catalog No.: ATL-HPA019625-25

Protein Description: tudor and KH domain containing
Gene Name: TDRKH
Alternative Gene Name: TDRD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041912: 85%, ENSRNOG00000020860: 86%
Entrez Gene ID: 11022
Uniprot ID: Q9Y2W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDL
• Gene Sequence: NTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDL
• Gene ID - Mouse: ENSMUSG00000041912
• Gene ID - Rat: ENSRNOG00000020860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.