Anti TCEAL5 pAb (ATL-HPA045564)

Atlas Antibodies

Catalog No.: ATL-HPA045564-25

Protein Description: transcription elongation factor A (SII)-like 5
Gene Name: TCEAL5
Alternative Gene Name: WEX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044550: 82%, ENSRNOG00000046280: 79%
Entrez Gene ID: 340543
Uniprot ID: Q5H9L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK
• Gene Sequence: PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK
• Gene ID - Mouse: ENSMUSG00000044550
• Gene ID - Rat: ENSRNOG00000046280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.