Anti TCEAL5 pAb (ATL-HPA045564)

Atlas Antibodies

SKU:
ATL-HPA045564-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A (SII)-like 5
Gene Name: TCEAL5
Alternative Gene Name: WEX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044550: 82%, ENSRNOG00000046280: 79%
Entrez Gene ID: 340543
Uniprot ID: Q5H9L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK
Gene Sequence PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK
Gene ID - Mouse ENSMUSG00000044550
Gene ID - Rat ENSRNOG00000046280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TCEAL5 pAb (ATL-HPA045564)
Datasheet Anti TCEAL5 pAb (ATL-HPA045564) Datasheet (External Link)
Vendor Page Anti TCEAL5 pAb (ATL-HPA045564) at Atlas Antibodies

Documents & Links for Anti TCEAL5 pAb (ATL-HPA045564)
Datasheet Anti TCEAL5 pAb (ATL-HPA045564) Datasheet (External Link)
Vendor Page Anti TCEAL5 pAb (ATL-HPA045564)