Anti TCEA3 pAb (ATL-HPA044960)

Atlas Antibodies

Catalog No.:
ATL-HPA044960-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A (SII), 3
Gene Name: TCEA3
Alternative Gene Name: TFIIS.H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001604: 84%, ENSRNOG00000011794: 85%
Entrez Gene ID: 6920
Uniprot ID: O75764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH
Gene Sequence AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH
Gene ID - Mouse ENSMUSG00000001604
Gene ID - Rat ENSRNOG00000011794
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCEA3 pAb (ATL-HPA044960)
Datasheet Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link)
Vendor Page Anti TCEA3 pAb (ATL-HPA044960) at Atlas Antibodies

Documents & Links for Anti TCEA3 pAb (ATL-HPA044960)
Datasheet Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link)
Vendor Page Anti TCEA3 pAb (ATL-HPA044960)