Anti TCEA3 pAb (ATL-HPA044960)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044960-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TCEA3
Alternative Gene Name: TFIIS.H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001604: 84%, ENSRNOG00000011794: 85%
Entrez Gene ID: 6920
Uniprot ID: O75764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH |
| Gene Sequence | AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH |
| Gene ID - Mouse | ENSMUSG00000001604 |
| Gene ID - Rat | ENSRNOG00000011794 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCEA3 pAb (ATL-HPA044960) | |
| Datasheet | Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link) |
| Vendor Page | Anti TCEA3 pAb (ATL-HPA044960) at Atlas Antibodies |
| Documents & Links for Anti TCEA3 pAb (ATL-HPA044960) | |
| Datasheet | Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link) |
| Vendor Page | Anti TCEA3 pAb (ATL-HPA044960) |