Anti TBX5 pAb (ATL-HPA008786)

Atlas Antibodies

Catalog No.:
ATL-HPA008786-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: T-box 5
Gene Name: TBX5
Alternative Gene Name: HOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018263: 92%, ENSRNOG00000001399: 92%
Entrez Gene ID: 6910
Uniprot ID: Q99593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Gene Sequence MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Gene ID - Mouse ENSMUSG00000018263
Gene ID - Rat ENSRNOG00000001399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBX5 pAb (ATL-HPA008786)
Datasheet Anti TBX5 pAb (ATL-HPA008786) Datasheet (External Link)
Vendor Page Anti TBX5 pAb (ATL-HPA008786) at Atlas Antibodies

Documents & Links for Anti TBX5 pAb (ATL-HPA008786)
Datasheet Anti TBX5 pAb (ATL-HPA008786) Datasheet (External Link)
Vendor Page Anti TBX5 pAb (ATL-HPA008786)
Citations for Anti TBX5 pAb (ATL-HPA008786) – 4 Found
Lian, Xiaojun; Zhang, Jianhua; Azarin, Samira M; Zhu, Kexian; Hazeltine, Laurie B; Bao, Xiaoping; Hsiao, Cheston; Kamp, Timothy J; Palecek, Sean P. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/β-catenin signaling under fully defined conditions. Nature Protocols. 2013;8(1):162-75.  PubMed
Kokkinopoulos, Ioannis; Ishida, Hidekazu; Saba, Rie; Ruchaya, Prashant; Cabrera, Claudia; Struebig, Monika; Barnes, Michael; Terry, Anna; Kaneko, Masahiro; Shintani, Yasunori; Coppen, Steven; Shiratori, Hidetaka; Ameen, Torath; Mein, Charles; Hamada, Hiroshi; Suzuki, Ken; Yashiro, Kenta. Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo. Plos One. 10(10):e0140831.  PubMed
Kathiriya, Irfan S; Rao, Kavitha S; Iacono, Giovanni; Devine, W Patrick; Blair, Andrew P; Hota, Swetansu K; Lai, Michael H; Garay, Bayardo I; Thomas, Reuben; Gong, Henry Z; Wasson, Lauren K; Goyal, Piyush; Sukonnik, Tatyana; Hu, Kevin M; Akgun, Gunes A; Bernard, Laure D; Akerberg, Brynn N; Gu, Fei; Li, Kai; Speir, Matthew L; Haeussler, Maximilian; Pu, William T; Stuart, Joshua M; Seidman, Christine E; Seidman, J G; Heyn, Holger; Bruneau, Benoit G. Modeling Human TBX5 Haploinsufficiency Predicts Regulatory Networks for Congenital Heart Disease. Developmental Cell. 2021;56(3):292-309.e9.  PubMed
Miyamoto, Matthew; Andersen, Peter; Sulistio, Edrick; Liu, Xihe; Murphy, Sean; Kannan, Suraj; Nam, Lucy; Miyamoto, William; Tampakakis, Emmanouil; Hibino, Narutoshi; Uosaki, Hideki; Kwon, Chulan. Noncanonical Notch signals have opposing roles during cardiac development. Biochemical And Biophysical Research Communications. 2021;577( 34487959):12-16.  PubMed