Anti TBX10 pAb (ATL-HPA047881)

Atlas Antibodies

SKU:
ATL-HPA047881-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: T-box 10
Gene Name: TBX10
Alternative Gene Name: TBX13, TBX7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037477: 68%, ENSRNOG00000017944: 64%
Entrez Gene ID: 347853
Uniprot ID: O75333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PARSHSSLSPCVLKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTR
Gene Sequence PARSHSSLSPCVLKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTR
Gene ID - Mouse ENSMUSG00000037477
Gene ID - Rat ENSRNOG00000017944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TBX10 pAb (ATL-HPA047881)
Datasheet Anti TBX10 pAb (ATL-HPA047881) Datasheet (External Link)
Vendor Page Anti TBX10 pAb (ATL-HPA047881) at Atlas Antibodies

Documents & Links for Anti TBX10 pAb (ATL-HPA047881)
Datasheet Anti TBX10 pAb (ATL-HPA047881) Datasheet (External Link)
Vendor Page Anti TBX10 pAb (ATL-HPA047881)