Anti TBP pAb (ATL-HPA049805)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049805-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TBP
Alternative Gene Name: GTF2D1, SCA17, TFIID
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014767: 88%, ENSRNOG00000001489: 88%
Entrez Gene ID: 6908
Uniprot ID: P20226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS |
| Gene Sequence | QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS |
| Gene ID - Mouse | ENSMUSG00000014767 |
| Gene ID - Rat | ENSRNOG00000001489 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBP pAb (ATL-HPA049805) | |
| Datasheet | Anti TBP pAb (ATL-HPA049805) Datasheet (External Link) |
| Vendor Page | Anti TBP pAb (ATL-HPA049805) at Atlas Antibodies |
| Documents & Links for Anti TBP pAb (ATL-HPA049805) | |
| Datasheet | Anti TBP pAb (ATL-HPA049805) Datasheet (External Link) |
| Vendor Page | Anti TBP pAb (ATL-HPA049805) |
| Citations for Anti TBP pAb (ATL-HPA049805) – 1 Found |
| Tjitro, Ryan; Campbell, Lee A; Basova, Liana; Johnson, Jessica; Najera, Julia A; Lindsey, Alexander; Marcondes, Maria Cecilia Garibaldi. Modeling the Function of TATA Box Binding Protein in Transcriptional Changes Induced by HIV-1 Tat in Innate Immune Cells and the Effect of Methamphetamine Exposure. Frontiers In Immunology. 9( 30778358):3110. PubMed |