Anti TBP pAb (ATL-HPA049805)

Atlas Antibodies

Catalog No.:
ATL-HPA049805-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TATA box binding protein
Gene Name: TBP
Alternative Gene Name: GTF2D1, SCA17, TFIID
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014767: 88%, ENSRNOG00000001489: 88%
Entrez Gene ID: 6908
Uniprot ID: P20226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS
Gene Sequence QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS
Gene ID - Mouse ENSMUSG00000014767
Gene ID - Rat ENSRNOG00000001489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBP pAb (ATL-HPA049805)
Datasheet Anti TBP pAb (ATL-HPA049805) Datasheet (External Link)
Vendor Page Anti TBP pAb (ATL-HPA049805) at Atlas Antibodies

Documents & Links for Anti TBP pAb (ATL-HPA049805)
Datasheet Anti TBP pAb (ATL-HPA049805) Datasheet (External Link)
Vendor Page Anti TBP pAb (ATL-HPA049805)
Citations for Anti TBP pAb (ATL-HPA049805) – 1 Found
Tjitro, Ryan; Campbell, Lee A; Basova, Liana; Johnson, Jessica; Najera, Julia A; Lindsey, Alexander; Marcondes, Maria Cecilia Garibaldi. Modeling the Function of TATA Box Binding Protein in Transcriptional Changes Induced by HIV-1 Tat in Innate Immune Cells and the Effect of Methamphetamine Exposure. Frontiers In Immunology. 9( 30778358):3110.  PubMed