Anti TBK1 pAb (ATL-HPA045797)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045797-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TBK1
Alternative Gene Name: NAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020115: 91%, ENSRNOG00000005528: 94%
Entrez Gene ID: 29110
Uniprot ID: Q9UHD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK |
Gene Sequence | MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK |
Gene ID - Mouse | ENSMUSG00000020115 |
Gene ID - Rat | ENSRNOG00000005528 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBK1 pAb (ATL-HPA045797) | |
Datasheet | Anti TBK1 pAb (ATL-HPA045797) Datasheet (External Link) |
Vendor Page | Anti TBK1 pAb (ATL-HPA045797) at Atlas Antibodies |
Documents & Links for Anti TBK1 pAb (ATL-HPA045797) | |
Datasheet | Anti TBK1 pAb (ATL-HPA045797) Datasheet (External Link) |
Vendor Page | Anti TBK1 pAb (ATL-HPA045797) |