Anti TBK1 pAb (ATL-HPA045797)

Atlas Antibodies

Catalog No.:
ATL-HPA045797-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: TANK-binding kinase 1
Gene Name: TBK1
Alternative Gene Name: NAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020115: 91%, ENSRNOG00000005528: 94%
Entrez Gene ID: 29110
Uniprot ID: Q9UHD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK
Gene Sequence MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK
Gene ID - Mouse ENSMUSG00000020115
Gene ID - Rat ENSRNOG00000005528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBK1 pAb (ATL-HPA045797)
Datasheet Anti TBK1 pAb (ATL-HPA045797) Datasheet (External Link)
Vendor Page Anti TBK1 pAb (ATL-HPA045797) at Atlas Antibodies

Documents & Links for Anti TBK1 pAb (ATL-HPA045797)
Datasheet Anti TBK1 pAb (ATL-HPA045797) Datasheet (External Link)
Vendor Page Anti TBK1 pAb (ATL-HPA045797)