Anti TBCEL pAb (ATL-HPA038594)

Atlas Antibodies

Catalog No.:
ATL-HPA038594-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tubulin folding cofactor E-like
Gene Name: TBCEL
Alternative Gene Name: LRRC35, MGC10233
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037287: 96%, ENSRNOG00000032364: 95%
Entrez Gene ID: 219899
Uniprot ID: Q5QJ74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLR
Gene Sequence VLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLR
Gene ID - Mouse ENSMUSG00000037287
Gene ID - Rat ENSRNOG00000032364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBCEL pAb (ATL-HPA038594)
Datasheet Anti TBCEL pAb (ATL-HPA038594) Datasheet (External Link)
Vendor Page Anti TBCEL pAb (ATL-HPA038594) at Atlas Antibodies

Documents & Links for Anti TBCEL pAb (ATL-HPA038594)
Datasheet Anti TBCEL pAb (ATL-HPA038594) Datasheet (External Link)
Vendor Page Anti TBCEL pAb (ATL-HPA038594)