Anti TBCC pAb (ATL-HPA035074 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035074-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TBCC
Alternative Gene Name: CFC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036430: 70%, ENSRNOG00000048291: 69%
Entrez Gene ID: 6903
Uniprot ID: Q15814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL |
| Gene Sequence | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL |
| Gene ID - Mouse | ENSMUSG00000036430 |
| Gene ID - Rat | ENSRNOG00000048291 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) | |
| Datasheet | Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) | |
| Datasheet | Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TBCC pAb (ATL-HPA035074 w/enhanced validation) |