Anti TBCC pAb (ATL-HPA035074 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035074-25

Protein Description: tubulin folding cofactor C
Gene Name: TBCC
Alternative Gene Name: CFC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036430: 70%, ENSRNOG00000048291: 69%
Entrez Gene ID: 6903
Uniprot ID: Q15814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL
• Gene Sequence: MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERL
• Gene ID - Mouse: ENSMUSG00000036430
• Gene ID - Rat: ENSRNOG00000048291
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.