Anti TBC1D2B pAb (ATL-HPA048174)

Atlas Antibodies

Catalog No.:
ATL-HPA048174-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 2B
Gene Name: TBC1D2B
Alternative Gene Name: KIAA1055
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037410: 75%, ENSRNOG00000014543: 77%
Entrez Gene ID: 23102
Uniprot ID: Q9UPU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGKRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKD
Gene Sequence DPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGKRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKD
Gene ID - Mouse ENSMUSG00000037410
Gene ID - Rat ENSRNOG00000014543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D2B pAb (ATL-HPA048174)
Datasheet Anti TBC1D2B pAb (ATL-HPA048174) Datasheet (External Link)
Vendor Page Anti TBC1D2B pAb (ATL-HPA048174) at Atlas Antibodies

Documents & Links for Anti TBC1D2B pAb (ATL-HPA048174)
Datasheet Anti TBC1D2B pAb (ATL-HPA048174) Datasheet (External Link)
Vendor Page Anti TBC1D2B pAb (ATL-HPA048174)