Anti TBC1D22A pAb (ATL-HPA001173)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001173-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TBC1D22A
Alternative Gene Name: C22orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051864: 92%, ENSRNOG00000059458: 59%
Entrez Gene ID: 25771
Uniprot ID: Q8WUA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFRWMNNLLMREVPLRCTIRLWDTYQSE |
| Gene Sequence | HPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFRWMNNLLMREVPLRCTIRLWDTYQSE |
| Gene ID - Mouse | ENSMUSG00000051864 |
| Gene ID - Rat | ENSRNOG00000059458 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBC1D22A pAb (ATL-HPA001173) | |
| Datasheet | Anti TBC1D22A pAb (ATL-HPA001173) Datasheet (External Link) |
| Vendor Page | Anti TBC1D22A pAb (ATL-HPA001173) at Atlas Antibodies |
| Documents & Links for Anti TBC1D22A pAb (ATL-HPA001173) | |
| Datasheet | Anti TBC1D22A pAb (ATL-HPA001173) Datasheet (External Link) |
| Vendor Page | Anti TBC1D22A pAb (ATL-HPA001173) |