Anti TBC1D13 pAb (ATL-HPA045865)

Atlas Antibodies

Catalog No.:
ATL-HPA045865-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 13
Gene Name: TBC1D13
Alternative Gene Name: FLJ10743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039678: 99%, ENSRNOG00000015970: 99%
Entrez Gene ID: 54662
Uniprot ID: Q9NVG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVAR
Gene Sequence EDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVAR
Gene ID - Mouse ENSMUSG00000039678
Gene ID - Rat ENSRNOG00000015970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D13 pAb (ATL-HPA045865)
Datasheet Anti TBC1D13 pAb (ATL-HPA045865) Datasheet (External Link)
Vendor Page Anti TBC1D13 pAb (ATL-HPA045865) at Atlas Antibodies

Documents & Links for Anti TBC1D13 pAb (ATL-HPA045865)
Datasheet Anti TBC1D13 pAb (ATL-HPA045865) Datasheet (External Link)
Vendor Page Anti TBC1D13 pAb (ATL-HPA045865)