Anti TAX1BP3 pAb (ATL-HPA063078)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063078-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TAX1BP3
Alternative Gene Name: TIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040158: 100%, ENSRNOG00000019357: 100%
Entrez Gene ID: 30851
Uniprot ID: O14907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Gene Sequence | PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Gene ID - Mouse | ENSMUSG00000040158 |
| Gene ID - Rat | ENSRNOG00000019357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TAX1BP3 pAb (ATL-HPA063078) | |
| Datasheet | Anti TAX1BP3 pAb (ATL-HPA063078) Datasheet (External Link) |
| Vendor Page | Anti TAX1BP3 pAb (ATL-HPA063078) at Atlas Antibodies |
| Documents & Links for Anti TAX1BP3 pAb (ATL-HPA063078) | |
| Datasheet | Anti TAX1BP3 pAb (ATL-HPA063078) Datasheet (External Link) |
| Vendor Page | Anti TAX1BP3 pAb (ATL-HPA063078) |