Anti TAX1BP3 pAb (ATL-HPA063078)
Atlas Antibodies
- SKU:
- ATL-HPA063078-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TAX1BP3
Alternative Gene Name: TIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040158: 100%, ENSRNOG00000019357: 100%
Entrez Gene ID: 30851
Uniprot ID: O14907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
Gene Sequence | PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
Gene ID - Mouse | ENSMUSG00000040158 |
Gene ID - Rat | ENSRNOG00000019357 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TAX1BP3 pAb (ATL-HPA063078) | |
Datasheet | Anti TAX1BP3 pAb (ATL-HPA063078) Datasheet (External Link) |
Vendor Page | Anti TAX1BP3 pAb (ATL-HPA063078) at Atlas Antibodies |
Documents & Links for Anti TAX1BP3 pAb (ATL-HPA063078) | |
Datasheet | Anti TAX1BP3 pAb (ATL-HPA063078) Datasheet (External Link) |
Vendor Page | Anti TAX1BP3 pAb (ATL-HPA063078) |