Anti TAX1BP3 pAb (ATL-HPA063078)

Atlas Antibodies

SKU: ATL-HPA063078-100

• 
• 

Protein Description: Tax1 (human T-cell leukemia virus type I) binding protein 3
Gene Name: TAX1BP3
Alternative Gene Name: TIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040158: 100%, ENSRNOG00000019357: 100%
Entrez Gene ID: 30851
Uniprot ID: O14907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Gene Sequence: PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Gene ID - Mouse: ENSMUSG00000040158
• Gene ID - Rat: ENSRNOG00000019357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.