Anti TAX1BP1 pAb (ATL-HPA024432)

Atlas Antibodies

Catalog No.: ATL-HPA024432-25

Protein Description: Tax1 (human T-cell leukemia virus type I) binding protein 1
Gene Name: TAX1BP1
Alternative Gene Name: CALCOCO3, TXBP151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004535: 80%, ENSRNOG00000008393: 79%
Entrez Gene ID: 8887
Uniprot ID: Q86VP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
• Gene Sequence: ADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
• Gene ID - Mouse: ENSMUSG00000004535
• Gene ID - Rat: ENSRNOG00000008393
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAX1BP1 pAb (ATL-HPA024432) – 12 Found

Petkova, Denitsa S; Verlhac, Pauline; Rozières, Aurore; Baguet, Joël; Claviere, Mathieu; Kretz-Remy, Carole; Mahieux, Renaud; Viret, Christophe; Faure, Mathias. Distinct Contributions of Autophagy Receptors in Measles Virus Replication. Viruses. 2017;9(5) 

Mejlvang, Jakob; Olsvik, Hallvard; Svenning, Steingrim; Bruun, Jack-Ansgar; Abudu, Yakubu Princely; Larsen, Kenneth Bowitz; Brech, Andreas; Hansen, Tom E; Brenne, Hanne; Hansen, Terkel; Stenmark, Harald; Johansen, Terje. Starvation induces rapid degradation of selective autophagy receptors by endosomal microautophagy. The Journal Of Cell Biology. 2018;217(10):3640-3655. 

Birgisdottir, Åsa Birna; Mouilleron, Stephane; Bhujabal, Zambarlal; Wirth, Martina; Sjøttem, Eva; Evjen, Gry; Zhang, Wenxin; Lee, Rebecca; O'Reilly, Nicola; Tooze, Sharon A; Lamark, Trond; Johansen, Terje. Members of the autophagy class III phosphatidylinositol 3-kinase complex I interact with GABARAP and GABARAPL1 via LIR motifs. Autophagy. 2019;15(8):1333-1355. 

Newman, Alice C; Scholefield, Caroline L; Kemp, Alain J; Newman, Michelle; McIver, Edward G; Kamal, Ahmad; Wilkinson, Simon. TBK1 kinase addiction in lung cancer cells is mediated via autophagy of Tax1bp1/Ndp52 and non-canonical NF-κB signalling. Plos One. 7(11):e50672. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Baillet, Nicolas; Krieger, Sophie; Journeaux, Alexandra; Caro, Valérie; Tangy, Frédéric; Vidalain, Pierre-Olivier; Baize, Sylvain. Autophagy Promotes Infectious Particle Production of Mopeia and Lassa Viruses. Viruses. 2019;11(3) 

Koerver, Lisa; Papadopoulos, Chrisovalantis; Liu, Bin; Kravic, Bojana; Rota, Giulia; Brecht, Lukas; Veenendaal, Tineke; Polajnar, Mira; Bluemke, Anika; Ehrmann, Michael; Klumperman, Judith; Jäättelä, Marja; Behrends, Christian; Meyer, Hemmo. The ubiquitin-conjugating enzyme UBE2QL1 coordinates lysophagy in response to endolysosomal damage. Embo Reports. 2019;20(10):e48014. 

Heo, Jin-Mi; Harper, Nathan J; Paulo, Joao A; Li, Mamie; Xu, Qikai; Coughlin, Margaret; Elledge, Stephen J; Harper, J Wade. Integrated proteogenetic analysis reveals the landscape of a mitochondrial-autophagosome synapse during PARK2-dependent mitophagy. Science Advances. 2019;5(11):eaay4624. 

Ohshima, Tomoko; Yamamoto, Hayashi; Sakamaki, Yuriko; Saito, Chieko; Mizushima, Noboru. NCOA4 drives ferritin phase separation to facilitate macroferritinophagy and microferritinophagy. The Journal Of Cell Biology. 2022;221(10) 

Xiong, Jian; Luu, Thi Thu Trang; Venkatachalam, Kartik; Du, Guangwei; Zhu, Michael X. Glutamine Produces Ammonium to Tune Lysosomal pH and Regulate Lysosomal Function. Cells. 2022;12(1) 

Qin, Wei; Myers, Samuel A; Carey, Dominique K; Carr, Steven A; Ting, Alice Y. Spatiotemporally-resolved mapping of RNA binding proteins via functional proximity labeling reveals a mitochondrial mRNA anchor promoting stress recovery. Nature Communications. 2021;12(1):4980. 

Kacal, Merve; Zhang, Boxi; Hao, Yuqing; Norberg, Erik; Vakifahmetoglu-Norberg, Helin. Quantitative proteomic analysis of temporal lysosomal proteome and the impact of the KFERQ-like motif and LAMP2A in lysosomal targeting. Autophagy. 2021;17(11):3865-3874.