Anti TAS2R39 pAb (ATL-HPA060680)

Atlas Antibodies

SKU: ATL-HPA060680-25

• 

Protein Description: taste receptor, type 2, member 39
Gene Name: TAS2R39
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051917: 58%, ENSRNOG00000028130: 52%
Entrez Gene ID: 259285
Uniprot ID: P59534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL
• Gene ID - Mouse: ENSMUSG00000051917
• Gene ID - Rat: ENSMUSG00000051917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.