Anti TAS2R39 pAb (ATL-HPA060680)
Atlas Antibodies
- SKU:
- ATL-HPA060680-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TAS2R39
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051917: 58%, ENSRNOG00000028130: 52%
Entrez Gene ID: 259285
Uniprot ID: P59534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL |
Gene ID - Mouse | ENSMUSG00000051917 |
Gene ID - Rat | ENSMUSG00000051917 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TAS2R39 pAb (ATL-HPA060680) | |
Datasheet | Anti TAS2R39 pAb (ATL-HPA060680) Datasheet (External Link) |
Vendor Page | Anti TAS2R39 pAb (ATL-HPA060680) at Atlas Antibodies |
Documents & Links for Anti TAS2R39 pAb (ATL-HPA060680) | |
Datasheet | Anti TAS2R39 pAb (ATL-HPA060680) Datasheet (External Link) |
Vendor Page | Anti TAS2R39 pAb (ATL-HPA060680) |