Anti TARDBP pAb (ATL-HPA017284)

Atlas Antibodies

Catalog No.: ATL-HPA017284-25

Protein Description: TAR DNA binding protein
Gene Name: TARDBP
Alternative Gene Name: ALS10, TDP-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041459: 96%, ENSRNOG00000012455: 32%
Entrez Gene ID: 23435
Uniprot ID: Q13148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
• Gene Sequence: VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
• Gene ID - Mouse: ENSMUSG00000041459
• Gene ID - Rat: ENSRNOG00000012455
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TARDBP pAb (ATL-HPA017284) – 4 Found

Sharma, Manu; Burré, Jacqueline; Südhof, Thomas C. CSPα promotes SNARE-complex assembly by chaperoning SNAP-25 during synaptic activity. Nature Cell Biology. 2011;13(1):30-9. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Tyleckova, Jirina; Hrabakova, Rita; Mairychova, Katerina; Halada, Petr; Radova, Lenka; Dzubak, Petr; Hajduch, Marian; Gadher, Suresh J; Kovarova, Hana. Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs. International Journal Of Molecular Sciences. 2012;13(12):15536-64. 

Sapaly, Delphine; Delers, Perrine; Coridon, Jennifer; Salman, Badih; Letourneur, Franck; Dumont, Florent; Lefebvre, Suzie. The Small-Molecule Flunarizine in Spinal Muscular Atrophy Patient Fibroblasts Impacts on the Gemin Components of the SMN Complex and TDP43, an RNA-Binding Protein Relevant to Motor Neuron Diseases. Frontiers In Molecular Biosciences. 7( 32363199):55.