Anti TAPT1 pAb (ATL-HPA048658)

Atlas Antibodies

Catalog No.:
ATL-HPA048658-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane anterior posterior transformation 1
Gene Name: TAPT1
Alternative Gene Name: FLJ90013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046985: 100%, ENSRNOG00000003174: 100%
Entrez Gene ID: 202018
Uniprot ID: Q6NXT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHL
Gene Sequence TLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHL
Gene ID - Mouse ENSMUSG00000046985
Gene ID - Rat ENSRNOG00000003174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAPT1 pAb (ATL-HPA048658)
Datasheet Anti TAPT1 pAb (ATL-HPA048658) Datasheet (External Link)
Vendor Page Anti TAPT1 pAb (ATL-HPA048658) at Atlas Antibodies

Documents & Links for Anti TAPT1 pAb (ATL-HPA048658)
Datasheet Anti TAPT1 pAb (ATL-HPA048658) Datasheet (External Link)
Vendor Page Anti TAPT1 pAb (ATL-HPA048658)
Citations for Anti TAPT1 pAb (ATL-HPA048658) – 1 Found
Nabavizadeh, Nasrinsadat; Bressin, Annkatrin; Shboul, Mohammad; Moreno Traspas, Ricardo; Chia, Poh Hui; Bonnard, Carine; Szenker-Ravi, Emmanuelle; Sarıbaş, Burak; Beillard, Emmanuel; Altunoglu, Umut; Hojati, Zohreh; Drutman, Scott; Freier, Susanne; El-Khateeb, Mohammad; Fathallah, Rajaa; Casanova, Jean-Laurent; Soror, Wesam; Arafat, Alaa; Escande-Beillard, Nathalie; Mayer, Andreas; Reversade, Bruno. A progeroid syndrome caused by a deep intronic variant in TAPT1 is revealed by RNA/SI-NET sequencing. Embo Molecular Medicine. 2023;15(2):e16478.  PubMed