Anti TAF1 pAb (ATL-HPA001075)

Atlas Antibodies

Catalog No.:
ATL-HPA001075-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Gene Name: TAF1
Alternative Gene Name: BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, NSCL2, TAF2A, TAFII250
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031314: 92%, ENSRNOG00000024647: 28%
Entrez Gene ID: 6872
Uniprot ID: P21675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Gene Sequence SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Gene ID - Mouse ENSMUSG00000031314
Gene ID - Rat ENSRNOG00000024647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAF1 pAb (ATL-HPA001075)
Datasheet Anti TAF1 pAb (ATL-HPA001075) Datasheet (External Link)
Vendor Page Anti TAF1 pAb (ATL-HPA001075) at Atlas Antibodies

Documents & Links for Anti TAF1 pAb (ATL-HPA001075)
Datasheet Anti TAF1 pAb (ATL-HPA001075) Datasheet (External Link)
Vendor Page Anti TAF1 pAb (ATL-HPA001075)
Citations for Anti TAF1 pAb (ATL-HPA001075) – 1 Found
Hernández, Ivó H; Cabrera, Jorge R; Santos-Galindo, María; Sánchez-Martín, Manuel; Domínguez, Verónica; García-Escudero, Ramón; Pérez-Álvarez, María J; Pintado, Belén; Lucas, José J. Pathogenic SREK1 decrease in Huntington's disease lowers TAF1 mimicking X-linked dystonia parkinsonism. Brain : A Journal Of Neurology. 2020;143(7):2207-2219.  PubMed