Anti TADA3 pAb (ATL-HPA042250)

Atlas Antibodies

Catalog No.: ATL-HPA042250-25

Protein Description: transcriptional adaptor 3
Gene Name: TADA3
Alternative Gene Name: ADA3, FLJ20221, FLJ21329, hADA3, NGG1, TADA3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048930: 100%, ENSRNOG00000008597: 100%
Entrez Gene ID: 10474
Uniprot ID: O75528
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
• Gene Sequence: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
• Gene ID - Mouse: ENSMUSG00000048930
• Gene ID - Rat: ENSRNOG00000008597
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TADA3 pAb (ATL-HPA042250) – 3 Found

Srivastava, Shashank; Mohibi, Shakur; Mirza, Sameer; Band, Hamid; Band, Vimla. Epidermal Growth Factor Receptor activation promotes ADA3 acetylation through the AKT-p300 pathway. Cell Cycle (Georgetown, Tex.). 2017;16(16):1515-1525. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Mohibi, Shakur; Srivastava, Shashank; Wang-France, Jun; Mirza, Sameer; Zhao, Xiangshan; Band, Hamid; Band, Vimla. Alteration/Deficiency in Activation 3 (ADA3) Protein, a Cell Cycle Regulator, Associates with the Centromere through CENP-B and Regulates Chromosome Segregation. The Journal Of Biological Chemistry. 2015;290(47):28299-28310.