Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005781-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: transforming, acidic coiled-coil containing protein 3
Gene Name: TACC3
Alternative Gene Name: ERIC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037313: 67%, ENSRNOG00000017259: 75%
Entrez Gene ID: 10460
Uniprot ID: Q9Y6A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
Gene Sequence MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
Gene ID - Mouse ENSMUSG00000037313
Gene ID - Rat ENSRNOG00000017259
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation)
Datasheet Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation)
Datasheet Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation)
Citations for Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation) – 1 Found
Guo, Yirui; Partch, Carrie L; Key, Jason; Card, Paul B; Pashkov, Victor; Patel, Anjana; Bruick, Richard K; Wurdak, Heiko; Gardner, Kevin H. Regulating the ARNT/TACC3 axis: multiple approaches to manipulating protein/protein interactions with small molecules. Acs Chemical Biology. 2013;8(3):626-35.  PubMed