Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005781-100

Protein Description: transforming, acidic coiled-coil containing protein 3
Gene Name: TACC3
Alternative Gene Name: ERIC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037313: 67%, ENSRNOG00000017259: 75%
Entrez Gene ID: 10460
Uniprot ID: Q9Y6A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
• Gene Sequence: MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
• Gene ID - Mouse: ENSMUSG00000037313
• Gene ID - Rat: ENSRNOG00000017259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TACC3 pAb (ATL-HPA005781 w/enhanced validation) – 1 Found

Guo, Yirui; Partch, Carrie L; Key, Jason; Card, Paul B; Pashkov, Victor; Patel, Anjana; Bruick, Richard K; Wurdak, Heiko; Gardner, Kevin H. Regulating the ARNT/TACC3 axis: multiple approaches to manipulating protein/protein interactions with small molecules. Acs Chemical Biology. 2013;8(3):626-35.