Anti TAB3 pAb (ATL-HPA034981)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034981-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TAB3
Alternative Gene Name: MAP3K7IP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035476: 86%, ENSRNOG00000003643: 86%
Entrez Gene ID: 257397
Uniprot ID: Q8N5C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT |
| Gene Sequence | RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT |
| Gene ID - Mouse | ENSMUSG00000035476 |
| Gene ID - Rat | ENSRNOG00000003643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TAB3 pAb (ATL-HPA034981) | |
| Datasheet | Anti TAB3 pAb (ATL-HPA034981) Datasheet (External Link) |
| Vendor Page | Anti TAB3 pAb (ATL-HPA034981) at Atlas Antibodies |
| Documents & Links for Anti TAB3 pAb (ATL-HPA034981) | |
| Datasheet | Anti TAB3 pAb (ATL-HPA034981) Datasheet (External Link) |
| Vendor Page | Anti TAB3 pAb (ATL-HPA034981) |