Anti TAB3 pAb (ATL-HPA034981)

Atlas Antibodies

Catalog No.: ATL-HPA034981-25

Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 3
Gene Name: TAB3
Alternative Gene Name: MAP3K7IP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035476: 86%, ENSRNOG00000003643: 86%
Entrez Gene ID: 257397
Uniprot ID: Q8N5C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
• Gene Sequence: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
• Gene ID - Mouse: ENSMUSG00000035476
• Gene ID - Rat: ENSRNOG00000003643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.