Anti SYVN1 pAb (ATL-HPA024300 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024300-25

Protein Description: synovial apoptosis inhibitor 1, synoviolin
Gene Name: SYVN1
Alternative Gene Name: DER3, HRD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024807: 100%, ENSRNOG00000020950: 99%
Entrez Gene ID: 84447
Uniprot ID: Q86TM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
• Gene Sequence: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
• Gene ID - Mouse: ENSMUSG00000024807
• Gene ID - Rat: ENSRNOG00000020950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYVN1 pAb (ATL-HPA024300 w/enhanced validation) – 3 Found

Wei, Juncheng; Yuan, Yanzhi; Chen, Lu; Xu, Yuanming; Zhang, Yuehui; Wang, Yajun; Yang, Yanjie; Peek, Clara Bien; Diebold, Lauren; Yang, Yi; Gao, Beixue; Jin, Chaozhi; Melo-Cardenas, Johanna; Chandel, Navdeep S; Zhang, Donna D; Pan, Hui; Zhang, Kezhong; Wang, Jian; He, Fuchu; Fang, Deyu. ER-associated ubiquitin ligase HRD1 programs liver metabolism by targeting multiple metabolic enzymes. Nature Communications. 2018;9(1):3659. 

Bhattacharya, Asmita; Wei, Juncheng; Song, Wenxin; Gao, Beixue; Tian, Chunyan; Wu, Shuangcheng Alivia; Wang, Jian; Chen, Ligong; Fang, Deyu; Qi, Ling. SEL1L-HRD1 ER-associated degradation suppresses hepatocyte hyperproliferation and liver cancer. Iscience. 2022;25(10):105183. 

Wei, Juncheng; Harada, Bryan T; Lu, Dan; Ma, Ruihua; Gao, Beixue; Xu, Yanan; Montauti, Elena; Mani, Nikita; Chaudhuri, Shuvam M; Gregory, Shana; Weinberg, Samuel E; Zhang, Donna D; Green, Richard; He, Chuan; Fang, Deyu. HRD1-mediated METTL14 degradation regulates m(6)A mRNA modification to suppress ER proteotoxic liver disease. Molecular Cell. 2021;81(24):5052-5065.e6.