Anti SYT17 pAb (ATL-HPA042059)

Atlas Antibodies

Catalog No.:
ATL-HPA042059-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptotagmin XVII
Gene Name: SYT17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058420: 93%, ENSRNOG00000017136: 95%
Entrez Gene ID: 51760
Uniprot ID: Q9BSW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTV
Gene Sequence PSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTV
Gene ID - Mouse ENSMUSG00000058420
Gene ID - Rat ENSRNOG00000017136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYT17 pAb (ATL-HPA042059)
Datasheet Anti SYT17 pAb (ATL-HPA042059) Datasheet (External Link)
Vendor Page Anti SYT17 pAb (ATL-HPA042059) at Atlas Antibodies

Documents & Links for Anti SYT17 pAb (ATL-HPA042059)
Datasheet Anti SYT17 pAb (ATL-HPA042059) Datasheet (External Link)
Vendor Page Anti SYT17 pAb (ATL-HPA042059)