Anti SYT17 pAb (ATL-HPA042059)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042059-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SYT17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058420: 93%, ENSRNOG00000017136: 95%
Entrez Gene ID: 51760
Uniprot ID: Q9BSW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTV |
Gene Sequence | PSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTV |
Gene ID - Mouse | ENSMUSG00000058420 |
Gene ID - Rat | ENSRNOG00000017136 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYT17 pAb (ATL-HPA042059) | |
Datasheet | Anti SYT17 pAb (ATL-HPA042059) Datasheet (External Link) |
Vendor Page | Anti SYT17 pAb (ATL-HPA042059) at Atlas Antibodies |
Documents & Links for Anti SYT17 pAb (ATL-HPA042059) | |
Datasheet | Anti SYT17 pAb (ATL-HPA042059) Datasheet (External Link) |
Vendor Page | Anti SYT17 pAb (ATL-HPA042059) |