Anti SYT13 pAb (ATL-HPA046224)

Atlas Antibodies

Catalog No.:
ATL-HPA046224-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptotagmin XIII
Gene Name: SYT13
Alternative Gene Name: KIAA1427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027220: 96%, ENSRNOG00000008000: 93%
Entrez Gene ID: 57586
Uniprot ID: Q7L8C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKE
Gene Sequence TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKE
Gene ID - Mouse ENSMUSG00000027220
Gene ID - Rat ENSRNOG00000008000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYT13 pAb (ATL-HPA046224)
Datasheet Anti SYT13 pAb (ATL-HPA046224) Datasheet (External Link)
Vendor Page Anti SYT13 pAb (ATL-HPA046224) at Atlas Antibodies

Documents & Links for Anti SYT13 pAb (ATL-HPA046224)
Datasheet Anti SYT13 pAb (ATL-HPA046224) Datasheet (External Link)
Vendor Page Anti SYT13 pAb (ATL-HPA046224)