Anti SYS1 pAb (ATL-HPA046716)

Atlas Antibodies

Catalog No.: ATL-HPA046716-25

Protein Description: Sys1 golgi trafficking protein
Gene Name: SYS1
Alternative Gene Name: C20orf169, dJ453C12.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090996: 97%, ENSRNOG00000014480: 97%
Entrez Gene ID: 90196
Uniprot ID: Q8N2H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
• Gene Sequence: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
• Gene ID - Mouse: ENSMUSG00000090996
• Gene ID - Rat: ENSRNOG00000014480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.