Anti SYPL1 pAb (ATL-HPA014141)

Atlas Antibodies

Catalog No.:
ATL-HPA014141-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synaptophysin-like 1
Gene Name: SYPL1
Alternative Gene Name: SYPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020570: 61%, ENSRNOG00000009856: 70%
Entrez Gene ID: 6856
Uniprot ID: Q16563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
Gene Sequence ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
Gene ID - Mouse ENSMUSG00000020570
Gene ID - Rat ENSRNOG00000009856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYPL1 pAb (ATL-HPA014141)
Datasheet Anti SYPL1 pAb (ATL-HPA014141) Datasheet (External Link)
Vendor Page Anti SYPL1 pAb (ATL-HPA014141) at Atlas Antibodies

Documents & Links for Anti SYPL1 pAb (ATL-HPA014141)
Datasheet Anti SYPL1 pAb (ATL-HPA014141) Datasheet (External Link)
Vendor Page Anti SYPL1 pAb (ATL-HPA014141)