Anti SYPL1 pAb (ATL-HPA014141)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014141-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SYPL1
Alternative Gene Name: SYPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020570: 61%, ENSRNOG00000009856: 70%
Entrez Gene ID: 6856
Uniprot ID: Q16563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATGHNIIDELPPCKKKAVLCYFGSVTSMGS |
| Gene Sequence | ATGHNIIDELPPCKKKAVLCYFGSVTSMGS |
| Gene ID - Mouse | ENSMUSG00000020570 |
| Gene ID - Rat | ENSRNOG00000009856 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYPL1 pAb (ATL-HPA014141) | |
| Datasheet | Anti SYPL1 pAb (ATL-HPA014141) Datasheet (External Link) |
| Vendor Page | Anti SYPL1 pAb (ATL-HPA014141) at Atlas Antibodies |
| Documents & Links for Anti SYPL1 pAb (ATL-HPA014141) | |
| Datasheet | Anti SYPL1 pAb (ATL-HPA014141) Datasheet (External Link) |
| Vendor Page | Anti SYPL1 pAb (ATL-HPA014141) |