Anti SYNJ2 pAb (ATL-HPA031575)

Atlas Antibodies

Catalog No.: ATL-HPA031575-25

Protein Description: synaptojanin 2
Gene Name: SYNJ2
Alternative Gene Name: INPP5H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023805: 81%, ENSRNOG00000017114: 81%
Entrez Gene ID: 8871
Uniprot ID: O15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEP
• Gene Sequence: HGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEP
• Gene ID - Mouse: ENSMUSG00000023805
• Gene ID - Rat: ENSRNOG00000017114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.