Anti SVBP pAb (ATL-HPA008507)

Atlas Antibodies

Catalog No.: ATL-HPA008507-25

Protein Description: small vasohibin binding protein
Gene Name: SVBP
Alternative Gene Name: CCDC23, MGC45441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028643: 94%, ENSRNOG00000007404: 94%
Entrez Gene ID: 374969
Uniprot ID: Q8N300
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
• Gene Sequence: DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
• Gene ID - Mouse: ENSMUSG00000028643
• Gene ID - Rat: ENSRNOG00000007404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.