Anti SV2C pAb (ATL-HPA040770)

Atlas Antibodies

Catalog No.:
ATL-HPA040770-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptic vesicle glycoprotein 2C
Gene Name: SV2C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051111: 96%, ENSRNOG00000018094: 96%
Entrez Gene ID: 22987
Uniprot ID: Q496J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYE
Gene Sequence GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYE
Gene ID - Mouse ENSMUSG00000051111
Gene ID - Rat ENSRNOG00000018094
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SV2C pAb (ATL-HPA040770)
Datasheet Anti SV2C pAb (ATL-HPA040770) Datasheet (External Link)
Vendor Page Anti SV2C pAb (ATL-HPA040770) at Atlas Antibodies

Documents & Links for Anti SV2C pAb (ATL-HPA040770)
Datasheet Anti SV2C pAb (ATL-HPA040770) Datasheet (External Link)
Vendor Page Anti SV2C pAb (ATL-HPA040770)