Anti SV2B pAb (ATL-HPA046247)

Atlas Antibodies

SKU: ATL-HPA046247-25

• 

Protein Description: synaptic vesicle glycoprotein 2B
Gene Name: SV2B
Alternative Gene Name: HsT19680, KIAA0735
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053025: 84%, ENSRNOG00000018094: 45%
Entrez Gene ID: 9899
Uniprot ID: Q7L1I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGR
• Gene Sequence: EYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGR
• Gene ID - Mouse: ENSMUSG00000053025
• Gene ID - Rat: ENSRNOG00000018094
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SV2B pAb (ATL-HPA046247) – 1 Found

Lekholm, Emilia; Ceder, Mikaela M; Forsberg, Erica C; Schiöth, Helgi B; Fredriksson, Robert. Differentiation of two human neuroblastoma cell lines alters SV2 expression patterns. Cellular & Molecular Biology Letters. 2021;26(1):5.