Anti SUSD6 pAb (ATL-HPA030464)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030464-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SUSD6
Alternative Gene Name: KIAA0247
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021133: 87%, ENSRNOG00000045941: 90%
Entrez Gene ID: 9766
Uniprot ID: Q92537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS |
| Gene Sequence | NGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS |
| Gene ID - Mouse | ENSMUSG00000021133 |
| Gene ID - Rat | ENSRNOG00000045941 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SUSD6 pAb (ATL-HPA030464) | |
| Datasheet | Anti SUSD6 pAb (ATL-HPA030464) Datasheet (External Link) |
| Vendor Page | Anti SUSD6 pAb (ATL-HPA030464) at Atlas Antibodies |
| Documents & Links for Anti SUSD6 pAb (ATL-HPA030464) | |
| Datasheet | Anti SUSD6 pAb (ATL-HPA030464) Datasheet (External Link) |
| Vendor Page | Anti SUSD6 pAb (ATL-HPA030464) |
| Citations for Anti SUSD6 pAb (ATL-HPA030464) – 2 Found |
| Xu, Yitong; Ren, Hongjiu; Jiang, Jun; Wang, Qiongzi; Wudu, Muli; Zhang, Qingfu; Su, Hongbo; Wang, Chenglong; Jiang, Lihong; Qiu, Xueshan. KIAA0247 inhibits growth, migration, invasion of non-small-cell lung cancer through regulating the Notch pathway. Cancer Science. 2018;109(4):1055-1065. PubMed |
| Xu, Yitong; Wang, Chenglong; Jiang, Xizi; Zhang, Yao; Su, Hongbo; Jiang, Jun; Ren, Hongjiu; Qiu, Xueshan. KLHL38 involvement in non-small cell lung cancer progression via activation of the Akt signaling pathway. Cell Death & Disease. 2021;12(6):556. PubMed |