Anti SUSD6 pAb (ATL-HPA030464)

Atlas Antibodies

Catalog No.:
ATL-HPA030464-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sushi domain containing 6
Gene Name: SUSD6
Alternative Gene Name: KIAA0247
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021133: 87%, ENSRNOG00000045941: 90%
Entrez Gene ID: 9766
Uniprot ID: Q92537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS
Gene Sequence NGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS
Gene ID - Mouse ENSMUSG00000021133
Gene ID - Rat ENSRNOG00000045941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUSD6 pAb (ATL-HPA030464)
Datasheet Anti SUSD6 pAb (ATL-HPA030464) Datasheet (External Link)
Vendor Page Anti SUSD6 pAb (ATL-HPA030464) at Atlas Antibodies

Documents & Links for Anti SUSD6 pAb (ATL-HPA030464)
Datasheet Anti SUSD6 pAb (ATL-HPA030464) Datasheet (External Link)
Vendor Page Anti SUSD6 pAb (ATL-HPA030464)
Citations for Anti SUSD6 pAb (ATL-HPA030464) – 2 Found
Xu, Yitong; Ren, Hongjiu; Jiang, Jun; Wang, Qiongzi; Wudu, Muli; Zhang, Qingfu; Su, Hongbo; Wang, Chenglong; Jiang, Lihong; Qiu, Xueshan. KIAA0247 inhibits growth, migration, invasion of non-small-cell lung cancer through regulating the Notch pathway. Cancer Science. 2018;109(4):1055-1065.  PubMed
Xu, Yitong; Wang, Chenglong; Jiang, Xizi; Zhang, Yao; Su, Hongbo; Jiang, Jun; Ren, Hongjiu; Qiu, Xueshan. KLHL38 involvement in non-small cell lung cancer progression via activation of the Akt signaling pathway. Cell Death & Disease. 2021;12(6):556.  PubMed