Anti SUSD3 pAb (ATL-HPA042310)

Atlas Antibodies

Catalog No.:
ATL-HPA042310-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sushi domain containing 3
Gene Name: SUSD3
Alternative Gene Name: MGC26847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021384: 78%, ENSRNOG00000016525: 80%
Entrez Gene ID: 203328
Uniprot ID: Q96L08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA
Gene Sequence TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA
Gene ID - Mouse ENSMUSG00000021384
Gene ID - Rat ENSRNOG00000016525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUSD3 pAb (ATL-HPA042310)
Datasheet Anti SUSD3 pAb (ATL-HPA042310) Datasheet (External Link)
Vendor Page Anti SUSD3 pAb (ATL-HPA042310) at Atlas Antibodies

Documents & Links for Anti SUSD3 pAb (ATL-HPA042310)
Datasheet Anti SUSD3 pAb (ATL-HPA042310) Datasheet (External Link)
Vendor Page Anti SUSD3 pAb (ATL-HPA042310)