Anti SUSD3 pAb (ATL-HPA042310)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042310-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SUSD3
Alternative Gene Name: MGC26847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021384: 78%, ENSRNOG00000016525: 80%
Entrez Gene ID: 203328
Uniprot ID: Q96L08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA |
Gene Sequence | TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA |
Gene ID - Mouse | ENSMUSG00000021384 |
Gene ID - Rat | ENSRNOG00000016525 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SUSD3 pAb (ATL-HPA042310) | |
Datasheet | Anti SUSD3 pAb (ATL-HPA042310) Datasheet (External Link) |
Vendor Page | Anti SUSD3 pAb (ATL-HPA042310) at Atlas Antibodies |
Documents & Links for Anti SUSD3 pAb (ATL-HPA042310) | |
Datasheet | Anti SUSD3 pAb (ATL-HPA042310) Datasheet (External Link) |
Vendor Page | Anti SUSD3 pAb (ATL-HPA042310) |