Anti SUPT5H pAb (ATL-HPA029273 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029273-100

Protein Description: suppressor of Ty 5 homolog (S. cerevisiae)
Gene Name: SUPT5H
Alternative Gene Name: FLJ34157, SPT5, SPT5H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003435: 96%, ENSRNOG00000032034: 96%
Entrez Gene ID: 6829
Uniprot ID: O00267
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL
• Gene Sequence: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL
• Gene ID - Mouse: ENSMUSG00000003435
• Gene ID - Rat: ENSRNOG00000032034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUPT5H pAb (ATL-HPA029273 w/enhanced validation) – 2 Found

Arabi, Azadeh; Ullah, Karim; Branca, Rui M M; Johansson, Johan; Bandarra, Daniel; Haneklaus, Moritz; Fu, Jing; Ariës, Ingrid; Nilsson, Peter; Den Boer, Monique L; Pokrovskaja, Katja; Grandér, Dan; Xiao, Gutian; Rocha, Sonia; Lehtiö, Janne; Sangfelt, Olle. Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway. Nature Communications. 3( 22864569):976. 

Chen, Rui; Zhu, Jing; Dong, Yong; He, Chao; Hu, Xiaotong. Suppressor of Ty homolog-5, a novel tumor-specific human telomerase reverse transcriptase promoter-binding protein and activator in colon cancer cells. Oncotarget. 2015;6(32):32841-55.