Anti SUPT20H pAb (ATL-HPA038907)

Atlas Antibodies

Catalog No.: ATL-HPA038907-25

Protein Description: suppressor of Ty 20 homolog (S. cerevisiae)
Gene Name: SUPT20H
Alternative Gene Name: bA421P11.4, C13orf19, FAM48A, P38IP, SPT20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027751: 92%, ENSRNOG00000059480: 94%
Entrez Gene ID: 55578
Uniprot ID: Q8NEM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDD
• Gene Sequence: RSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDD
• Gene ID - Mouse: ENSMUSG00000027751
• Gene ID - Rat: ENSRNOG00000059480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.