Anti SUN3 pAb (ATL-HPA008344 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008344-25

Protein Description: Sad1 and UNC84 domain containing 3
Gene Name: SUN3
Alternative Gene Name: MGC33329, SUNC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040985: 72%, ENSRNOG00000005105: 69%
Entrez Gene ID: 256979
Uniprot ID: Q8TAQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVN
• Gene Sequence: TDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVN
• Gene ID - Mouse: ENSMUSG00000040985
• Gene ID - Rat: ENSRNOG00000005105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUN3 pAb (ATL-HPA008344 w/enhanced validation) – 1 Found

Lindskog, Cecilia; Asplund, Anna; Engkvist, Margareta; Uhlen, Mathias; Korsgren, Olle; Ponten, Fredrik. Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets. Discovery Medicine. 2010;9(49):565-78.