Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008346-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SUN1
Alternative Gene Name: FLJ12407, KIAA0810, UNC84A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036817: 59%, ENSRNOG00000001299: 58%
Entrez Gene ID: 23353
Uniprot ID: O94901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS |
| Gene Sequence | QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS |
| Gene ID - Mouse | ENSMUSG00000036817 |
| Gene ID - Rat | ENSRNOG00000001299 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) | |
| Datasheet | Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) | |
| Datasheet | Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) |
| Citations for Anti SUN1 pAb (ATL-HPA008346 w/enhanced validation) – 19 Found |
| Nishioka, Yu; Imaizumi, Hiromasa; Imada, Junko; Katahira, Jun; Matsuura, Nariaki; Hieda, Miki. SUN1 splice variants, SUN1_888, SUN1_785, and predominant SUN1_916, variably function in directional cell migration. Nucleus (Austin, Tex.). 2016;7(6):572-584. PubMed |
| Lu, Xiang; Djabali, Karima. Autophagic Removal of Farnesylated Carboxy-Terminal Lamin Peptides. Cells. 2018;7(4) PubMed |
| Hintze, Stefan; Knaier, Lisa; Limmer, Sarah; Schoser, Benedikt; Meinke, Peter. Nuclear Envelope Transmembrane Proteins in Myotonic Dystrophy Type 1. Frontiers In Physiology. 9( 30425655):1532. PubMed |
| Arnold, Rouven; Vehns, Elena; Randl, Hannah; Djabali, Karima. Baricitinib, a JAK-STAT Inhibitor, Reduces the Cellular Toxicity of the Farnesyltransferase Inhibitor Lonafarnib in Progeria Cells. International Journal Of Molecular Sciences. 2021;22(14) PubMed |
| Chiarini, Francesca; Paganelli, Francesca; Balestra, Tommaso; Capanni, Cristina; Fazio, Antonietta; Manara, Maria Cristina; Landuzzi, Lorena; Petrini, Stefania; Evangelisti, Camilla; Lollini, Pier-Luigi; Martelli, Alberto M; Lattanzi, Giovanna; Scotlandi, Katia. Lamin A and the LINC complex act as potential tumor suppressors in Ewing Sarcoma. Cell Death & Disease. 2022;13(4):346. PubMed |
| Ueda, Nanami; Maekawa, Masashi; Matsui, Tsubasa S; Deguchi, Shinji; Takata, Tomoyo; Katahira, Jun; Higashiyama, Shigeki; Hieda, Miki. Inner Nuclear Membrane Protein, SUN1, is Required for Cytoskeletal Force Generation and Focal Adhesion Maturation. Frontiers In Cell And Developmental Biology. 10( 35663386):885859. PubMed |
| Ramachandran, Rajesh; Pucadyil, Thomas J; Liu, Ya-Wen; Acharya, Sharmistha; Leonard, Marilyn; Lukiyanchuk, Vasyl; Schmid, Sandra L. Membrane insertion of the pleckstrin homology domain variable loop 1 is critical for dynamin-catalyzed vesicle scission. Molecular Biology Of The Cell. 2009;20(22):4630-9. PubMed |
| Zwerger, Monika; Kolb, Thorsten; Richter, Karsten; Karakesisoglou, Iakowos; Herrmann, Harald. Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7. Molecular Biology Of The Cell. 2010;21(2):354-68. PubMed |
| Gudise, Santhosh; Figueroa, Ricardo A; Lindberg, Robert; Larsson, Veronica; Hallberg, Einar. Samp1 is functionally associated with the LINC complex and A-type lamina networks. Journal Of Cell Science. 2011;124(Pt 12):2077-85. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Crabbe, Laure; Cesare, Anthony J; Kasuboski, James M; Fitzpatrick, James A J; Karlseder, Jan. Human telomeres are tethered to the nuclear envelope during postmitotic nuclear assembly. Cell Reports. 2012;2(6):1521-9. PubMed |
| Horn, Henning F; Kim, Dae In; Wright, Graham D; Wong, Esther Sook Miin; Stewart, Colin L; Burke, Brian; Roux, Kyle J. A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton. The Journal Of Cell Biology. 2013;202(7):1023-39. PubMed |
| Meinke, Peter; Mattioli, Elisabetta; Haque, Farhana; Antoku, Susumu; Columbaro, Marta; Straatman, Kees R; Worman, Howard J; Gundersen, Gregg G; Lattanzi, Giovanna; Wehnert, Manfred; Shackleton, Sue. Muscular dystrophy-associated SUN1 and SUN2 variants disrupt nuclear-cytoskeletal connections and myonuclear organization. Plos Genetics. 2014;10(9):e1004605. PubMed |
| Eisch, Veronika; Lu, Xiang; Gabriel, Diana; Djabali, Karima. Progerin impairs chromosome maintenance by depleting CENP-F from metaphase kinetochores in Hutchinson-Gilford progeria fibroblasts. Oncotarget. 2016;7(17):24700-18. PubMed |
| Holt, Ian; Fuller, Heidi R; Lam, Le Thanh; Sewry, Caroline A; Shirran, Sally L; Zhang, Qiuping; Shanahan, Catherine M; Morris, Glenn E. Nesprin-1-alpha2 associates with kinesin at myotube outer nuclear membranes, but is restricted to neuromuscular junction nuclei in adult muscle. Scientific Reports. 2019;9(1):14202. PubMed |
| Röhrl, Jennifer M; Arnold, Rouven; Djabali, Karima. Nuclear Pore Complexes Cluster in Dysmorphic Nuclei of Normal and Progeria Cells during Replicative Senescence. Cells. 2021;10(1) PubMed |
| Hieda, Miki; Matsumoto, Taizo; Isobe, Mari; Kurono, Sadamu; Yuka, Kaneko; Kametaka, Satoshi; Wang, Jing-Ya; Chi, Ya-Hui; Kameda, Kenji; Kimura, Hiroshi; Matsuura, Nariaki; Matsuura, Shuji. The SUN2-nesprin-2 LINC complex and KIF20A function in the Golgi dispersal. Scientific Reports. 2021;11(1):5358. PubMed |
| Cavazza, Tommaso; Takeda, Yuko; Politi, Antonio Z; Aushev, Magomet; Aldag, Patrick; Baker, Clara; Choudhary, Meenakshi; Bucevičius, Jonas; Lukinavičius, Gražvydas; Elder, Kay; Blayney, Martyn; Lucas-Hahn, Andrea; Niemann, Heiner; Herbert, Mary; Schuh, Melina. Parental genome unification is highly error-prone in mammalian embryos. Cell. 2021;184(11):2860-2877.e22. PubMed |
| Kychygina, Anna; Dall'Osto, Marina; Allen, Joshua A M; Cadoret, Jean-Charles; Piras, Vincent; Pickett, Hilda A; Crabbe, Laure. Progerin impairs 3D genome organization and induces fragile telomeres by limiting the dNTP pools. Scientific Reports. 2021;11(1):13195. PubMed |