Anti SUMO2 pAb (ATL-HPA048064)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048064-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SUMO2
Alternative Gene Name: SMT3B, SMT3H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020265: 100%, ENSRNOG00000003670: 100%
Entrez Gene ID: 6613
Uniprot ID: P61956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC |
Gene Sequence | HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC |
Gene ID - Mouse | ENSMUSG00000020265 |
Gene ID - Rat | ENSRNOG00000003670 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SUMO2 pAb (ATL-HPA048064) | |
Datasheet | Anti SUMO2 pAb (ATL-HPA048064) Datasheet (External Link) |
Vendor Page | Anti SUMO2 pAb (ATL-HPA048064) at Atlas Antibodies |
Documents & Links for Anti SUMO2 pAb (ATL-HPA048064) | |
Datasheet | Anti SUMO2 pAb (ATL-HPA048064) Datasheet (External Link) |
Vendor Page | Anti SUMO2 pAb (ATL-HPA048064) |