Anti SUMO2 pAb (ATL-HPA048064)

Atlas Antibodies

Catalog No.: ATL-HPA048064-25

Protein Description: small ubiquitin-like modifier 2
Gene Name: SUMO2
Alternative Gene Name: SMT3B, SMT3H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020265: 100%, ENSRNOG00000003670: 100%
Entrez Gene ID: 6613
Uniprot ID: P61956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC
• Gene Sequence: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC
• Gene ID - Mouse: ENSMUSG00000020265
• Gene ID - Rat: ENSRNOG00000003670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.