Anti SUMF1 pAb (ATL-HPA038025)

Atlas Antibodies

Catalog No.:
ATL-HPA038025-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sulfatase modifying factor 1
Gene Name: SUMF1
Alternative Gene Name: FGE, UNQ3037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030101: 93%, ENSRNOG00000006813: 91%
Entrez Gene ID: 285362
Uniprot ID: Q8NBK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
Gene Sequence MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
Gene ID - Mouse ENSMUSG00000030101
Gene ID - Rat ENSRNOG00000006813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUMF1 pAb (ATL-HPA038025)
Datasheet Anti SUMF1 pAb (ATL-HPA038025) Datasheet (External Link)
Vendor Page Anti SUMF1 pAb (ATL-HPA038025) at Atlas Antibodies

Documents & Links for Anti SUMF1 pAb (ATL-HPA038025)
Datasheet Anti SUMF1 pAb (ATL-HPA038025) Datasheet (External Link)
Vendor Page Anti SUMF1 pAb (ATL-HPA038025)