Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041487-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SULT2A1
Alternative Gene Name: DHEA-ST, STD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074377: 61%, ENSRNOG00000047986: 60%
Entrez Gene ID: 6822
Uniprot ID: Q06520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS |
| Gene Sequence | GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS |
| Gene ID - Mouse | ENSMUSG00000074377 |
| Gene ID - Rat | ENSRNOG00000047986 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) | |
| Datasheet | Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) | |
| Datasheet | Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) |
| Citations for Anti SULT2A1 pAb (ATL-HPA041487 w/enhanced validation) – 1 Found |
| Melau, Cecilie; Nielsen, John Erik; Frederiksen, Hanne; Kilcoyne, Karen; Perlman, Signe; Lundvall, Lene; Langhoff Thuesen, Lea; Juul Hare, Kristine; Andersson, Anna-Maria; Mitchell, Rod T; Juul, Anders; Jørgensen, Anne. Characterization of Human Adrenal Steroidogenesis During Fetal Development. The Journal Of Clinical Endocrinology And Metabolism. 2019;104(5):1802-1812. PubMed |