Anti SULT1E1 pAb (ATL-HPA028728 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028728-100

Protein Description: sulfotransferase family 1E, estrogen-preferring, member 1
Gene Name: SULT1E1
Alternative Gene Name: EST, STE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029272: 78%, ENSRNOG00000001957: 74%
Entrez Gene ID: 6783
Uniprot ID: P49888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEI
• Gene Sequence: VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEI
• Gene ID - Mouse: ENSMUSG00000029272
• Gene ID - Rat: ENSRNOG00000001957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SULT1E1 pAb (ATL-HPA028728 w/enhanced validation) – 4 Found

Sinreih, Maša; Knific, Tamara; Anko, Maja; Hevir, Neli; Vouk, Katja; Jerin, Aleš; Frković Grazio, Snježana; Rižner, Tea Lanišnik. The Significance of the Sulfatase Pathway for Local Estrogen Formation in Endometrial Cancer. Frontiers In Pharmacology. 8( 28690541):368. 

Kilanczyk, Ewa; Ruminkiewicz, Dagmara; Banales, Jesus M; Milkiewicz, Piotr; Milkiewicz, Małgorzata. DHEA Protects Human Cholangiocytes and Hepatocytes against Apoptosis and Oxidative Stress. Cells. 2022;11(6) 

Fischer, L; Deppert, W R; Pfeifer, D; Stanzel, S; Weimer, M; Hanjalic-Beck, A; Stein, A; Straßer, M; Zahradnik, H P; Schaefer, W R. Potential hazards to embryo implantation: A human endometrial in vitro model to identify unwanted antigestagenic actions of chemicals. Toxicology And Applied Pharmacology. 2012;260(3):232-40. 

Lecante, Laetitia L; Leverrier-Penna, Sabrina; Gicquel, Thomas; Giton, Frank; Costet, Nathalie; Desdoits-Lethimonier, Christèle; Lesné, Laurianne; Fromenty, Bernard; Lavoué, Vincent; Rolland, Antoine D; Mazaud-Guittot, Séverine. Acetaminophen (APAP, Paracetamol) Interferes With the First Trimester Human Fetal Ovary Development in an Ex Vivo Model. The Journal Of Clinical Endocrinology And Metabolism. 2022;107(6):1647-1661.