Anti SULT1E1 pAb (ATL-HPA028213)

Atlas Antibodies

Catalog No.: ATL-HPA028213-100

Protein Description: sulfotransferase family 1E, estrogen-preferring, member 1
Gene Name: SULT1E1
Alternative Gene Name: EST, STE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029272: 82%, ENSRNOG00000001957: 78%
Entrez Gene ID: 6783
Uniprot ID: P49888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPEL
• Gene Sequence: PKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPEL
• Gene ID - Mouse: ENSMUSG00000029272
• Gene ID - Rat: ENSRNOG00000001957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.