Anti SULT1A2 pAb (ATL-HPA051051)

Atlas Antibodies

Catalog No.:
ATL-HPA051051-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
Gene Name: SULT1A2
Alternative Gene Name: HAST4, STP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030711: 54%, ENSRNOG00000019342: 66%
Entrez Gene ID: 6799
Uniprot ID: P50226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
Gene Sequence ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
Gene ID - Mouse ENSMUSG00000030711
Gene ID - Rat ENSRNOG00000019342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SULT1A2 pAb (ATL-HPA051051)
Datasheet Anti SULT1A2 pAb (ATL-HPA051051) Datasheet (External Link)
Vendor Page Anti SULT1A2 pAb (ATL-HPA051051) at Atlas Antibodies

Documents & Links for Anti SULT1A2 pAb (ATL-HPA051051)
Datasheet Anti SULT1A2 pAb (ATL-HPA051051) Datasheet (External Link)
Vendor Page Anti SULT1A2 pAb (ATL-HPA051051)
Citations for Anti SULT1A2 pAb (ATL-HPA051051) – 1 Found
Chao, Yinghui; Ou, Qifeng; Shang, Jin. Expression and prognostic value of SULT1A2 in bladder cancer. Experimental And Therapeutic Medicine. 2021;22(1):779.  PubMed